SCOPe 2.07: Domain d1z1sa1: 1z1s A:1-129

Lineage for d1z1sa1 (1z1s A:1-129)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)

6. Protein Uncharacterized protein PA3332 [159977] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159978] (2 PDB entries)
   Uniprot Q9HYR3 1-129

8. Domain d1z1sa1: 1z1s A:1-129 [145958]
   Other proteins in same PDB: d1z1sa2
   complexed with mg, pge

Details for d1z1sa1

PDB Entry: 1z1s, 1.49 Å

PDB Description: Crystal Structure of Putative Isomerase PA3332 from Pseudomonas aeruginosa

PDB Compounds: (A:) Hypothetical Protein PA3332

SCOPe Domain Sequences for d1z1sa1:

Sequence; same for both SEQRES and ATOM records:

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
mnakeilvhslrllengdargwcdlfhpegvlefpyappgwktrfegretiwahmrlfpe
hltvrftdvqfyetadpdlaigefhgdgvatvsggklaqdyisvlrtrdgqillyrdfwn
plrhlealg

Timeline for d1z1sa1:

• d1z1sa1 first appeared in SCOP 1.75
  
• d1z1sa1 appears in SCOPe 2.06
  
• d1z1sa1 appears in the current release, SCOPe 2.08