![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
![]() | Protein Uncharacterized protein PA3332 [159977] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [159978] (2 PDB entries) Uniprot Q9HYR3 1-129 |
![]() | Domain d1z1sa1: 1z1s A:1-129 [145958] Other proteins in same PDB: d1z1sa2 complexed with mg, pge |
PDB Entry: 1z1s (more details), 1.49 Å
SCOPe Domain Sequences for d1z1sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} mnakeilvhslrllengdargwcdlfhpegvlefpyappgwktrfegretiwahmrlfpe hltvrftdvqfyetadpdlaigefhgdgvatvsggklaqdyisvlrtrdgqillyrdfwn plrhlealg
Timeline for d1z1sa1: