Lineage for d1z1sa1 (1z1s A:1-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855976Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 855991Protein Uncharacterized protein PA3332 [159977] (1 species)
  7. 855992Species Pseudomonas aeruginosa [TaxId:287] [159978] (1 PDB entry)
    Uniprot Q9HYR3 1-129
  8. 855993Domain d1z1sa1: 1z1s A:1-129 [145958]
    complexed with mg, pge

Details for d1z1sa1

PDB Entry: 1z1s (more details), 1.49 Å

PDB Description: Crystal Structure of Putative Isomerase PA3332 from Pseudomonas aeruginosa
PDB Compounds: (A:) Hypothetical Protein PA3332

SCOP Domain Sequences for d1z1sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
mnakeilvhslrllengdargwcdlfhpegvlefpyappgwktrfegretiwahmrlfpe
hltvrftdvqfyetadpdlaigefhgdgvatvsggklaqdyisvlrtrdgqillyrdfwn
plrhlealg

SCOP Domain Coordinates for d1z1sa1:

Click to download the PDB-style file with coordinates for d1z1sa1.
(The format of our PDB-style files is described here.)

Timeline for d1z1sa1: