SCOPe 2.05: Domain d1z0na1: 1z0n A:77-163

Lineage for d1z0na1 (1z0n A:77-163)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein 5'-AMP-activated protein kinase subunit beta-1 [158891] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [158892] (2 PDB entries)
   Uniprot P80386 76-162

8. Domain d1z0na1: 1z0n A:77-163 [145955]
   Other proteins in same PDB: d1z0nb_, d1z0nc_
   complexed with bcd

Details for d1z0na1

PDB Entry: 1z0n, 1.49 Å

PDB Description: the glycogen-binding domain of the amp-activated protein kinase

PDB Compounds: (A:) 5'-AMP-activated protein kinase, beta-1 subunit

SCOPe Domain Sequences for d1z0na1:

Sequence; same for both SEQRES and ATOM records:

>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
psepivtsqlgtvnniiqvkktdfevf

Timeline for d1z0na1:

• d1z0na1 first appeared in SCOP 1.75
  
• d1z0na1 appears in SCOPe 2.04
  
• d1z0na1 appears in SCOPe 2.06
  
• d1z0na1 appears in the current release, SCOPe 2.08