Lineage for d1z0na1 (1z0n A:77-163)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765993Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 2765994Protein 5'-AMP-activated protein kinase subunit beta-1 [158891] (1 species)
  7. 2765995Species Norway rat (Rattus norvegicus) [TaxId:10116] [158892] (2 PDB entries)
    Uniprot P80386 76-162
  8. 2765996Domain d1z0na1: 1z0n A:77-163 [145955]
    Other proteins in same PDB: d1z0nb_, d1z0nc_

Details for d1z0na1

PDB Entry: 1z0n (more details), 1.49 Å

PDB Description: the glycogen-binding domain of the amp-activated protein kinase
PDB Compounds: (A:) 5'-AMP-activated protein kinase, beta-1 subunit

SCOPe Domain Sequences for d1z0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
psepivtsqlgtvnniiqvkktdfevf

SCOPe Domain Coordinates for d1z0na1:

Click to download the PDB-style file with coordinates for d1z0na1.
(The format of our PDB-style files is described here.)

Timeline for d1z0na1: