SCOPe 2.04: Domain d1z09a_: 1z09 A:

Lineage for d1z09a_ (1z09 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118075] (2 PDB entries)
   Uniprot Q9NP97

8. Domain d1z09a_: 1z09 A: [145950]
   automated match to d1z09a1

Details for d1z09a_

PDB Entry: 1z09

PDB Description: solution structure of km23

PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d1z09a_:

Sequence; same for both SEQRES and ATOM records:

>d1z09a_ d.110.7.1 (A:) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

Timeline for d1z09a_:

• d1z09a_ first appeared in SCOP 1.75, called d1z09a1
  
• d1z09a_ was called d1z09a1 in SCOPe 2.03
  
• d1z09a_ appears in SCOPe 2.05
  
• d1z09a_ appears in the current release, SCOPe 2.08