Lineage for d1z09a1 (1z09 A:1-96)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215605Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1216069Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 1216070Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 1216071Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. 1216072Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries)
    Uniprot Q9NP97
  8. 1216073Domain d1z09a1: 1z09 A:1-96 [145950]
    automatically matched to 2B95 A:11-106

Details for d1z09a1

PDB Entry: 1z09 (more details)

PDB Description: solution structure of km23
PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d1z09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z09a1 d.110.7.1 (A:1-96) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

SCOPe Domain Coordinates for d1z09a1:

Click to download the PDB-style file with coordinates for d1z09a1.
(The format of our PDB-style files is described here.)

Timeline for d1z09a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z09b1