Lineage for d1z09a_ (1z09 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries)
    Uniprot Q9NP97
  8. Domain d1z09a_: 1z09 A: [145950]
    automated match to d1z09a1

Details for d1z09a_

PDB Entry: 1z09 (more details)

PDB Description: Solution structure of km23
PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d1z09a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z09a_ d.110.7.1 (A:) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

SCOPe Domain Coordinates for d1z09a_ are not available.

Timeline for d1z09a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z09b_