Lineage for d1yzsa1 (1yzs A:17-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009272Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 3009273Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. 3009308Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins)
    PfamB PB015736
  6. 3009309Protein Sulfiredoxin [160096] (1 species)
  7. 3009310Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries)
    Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137
  8. 3009317Domain d1yzsa1: 1yzs A:17-137 [145949]

Details for d1yzsa1

PDB Entry: 1yzs (more details)

PDB Description: solution structure of human sulfiredoxin (srx)
PDB Compounds: (A:) Sulfiredoxin

SCOPe Domain Sequences for d1yzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzsa1 d.268.1.4 (A:17-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]}
gapegpgpsggaqggsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsv
ppidvlwikgaqggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdl
q

SCOPe Domain Coordinates for d1yzsa1:

Click to download the PDB-style file with coordinates for d1yzsa1.
(The format of our PDB-style files is described here.)

Timeline for d1yzsa1: