![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily) beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8) |
![]() | Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) ![]() |
![]() | Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins) PfamB PB015736 |
![]() | Protein Sulfiredoxin [160096] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries) Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137 |
![]() | Domain d1yzsa1: 1yzs A:17-137 [145949] |
PDB Entry: 1yzs (more details)
SCOPe Domain Sequences for d1yzsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzsa1 d.268.1.4 (A:17-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]} gapegpgpsggaqggsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsv ppidvlwikgaqggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdl q
Timeline for d1yzsa1: