Lineage for d1ywhi1 (1ywh I:92-188)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890476Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species)
    duplication; comprises three domains of this fold
  7. 890477Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries)
    Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104
  8. 890496Domain d1ywhi1: 1ywh I:92-188 [145937]
    automatically matched to 1YWH A:89-188
    complexed with alc, bma, fuc, man, nag, ndg, so4

Details for d1ywhi1

PDB Entry: 1ywh (more details), 2.7 Å

PDB Description: crystal structure of urokinase plasminogen activator receptor
PDB Compounds: (I:) Urokinase plasminogen activator surface receptor

SCOP Domain Sequences for d1ywhi1:

Sequence, based on SEQRES records: (download)

>d1ywhi1 g.7.1.3 (I:92-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
yleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgylp
gcpgsngfhnndtfhflkccnttkcnegpilelenlp

Sequence, based on observed residues (ATOM records): (download)

>d1ywhi1 g.7.1.3 (I:92-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
yleciscgssdmscergrhqslqcrspeeqcldvvthwiqrpkddrhlrgcgylpgcpgs
ngfhnndtfhflkccnttkcnegpilelenlp

SCOP Domain Coordinates for d1ywhi1:

Click to download the PDB-style file with coordinates for d1ywhi1.
(The format of our PDB-style files is described here.)

Timeline for d1ywhi1: