Lineage for d1yrub1 (1yru B:80-144)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768955Protein Caltractin (centrin 2) [89053] (2 species)
  7. 768958Species Human (Homo sapiens) [TaxId:9606] [89054] (5 PDB entries)
  8. 768962Domain d1yrub1: 1yru B:80-144 [145924]
    automatically matched to d1m39a_
    complexed with ca

Details for d1yrub1

PDB Entry: 1yru (more details), 2.5 Å

PDB Description: Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of Bordetella pertussis in presence of c-terminal calmodulin and 1mM calcium chloride
PDB Compounds: (B:) calmodulin

SCOP Domain Sequences for d1yrub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrub1 a.39.1.5 (B:80-144) Caltractin (centrin 2) {Human (Homo sapiens) [TaxId: 9606]}
dseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnye
efvqm

SCOP Domain Coordinates for d1yrub1:

Click to download the PDB-style file with coordinates for d1yrub1.
(The format of our PDB-style files is described here.)

Timeline for d1yrub1: