SCOP 1.75: Domain d1yrub1: 1yru B:80-144

Lineage for d1yrub1 (1yru B:80-144)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Caltractin (centrin 2) [89053] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89054] (5 PDB entries)

8. Domain d1yrub1: 1yru B:80-144 [145924]
   automatically matched to d1m39a_
   complexed with ca

Details for d1yrub1

PDB Entry: 1yru, 2.5 Å

PDB Description: Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of Bordetella pertussis in presence of c-terminal calmodulin and 1mM calcium chloride

PDB Compounds: (B:) calmodulin

SCOP Domain Sequences for d1yrub1:

Sequence; same for both SEQRES and ATOM records:

>d1yrub1 a.39.1.5 (B:80-144) Caltractin (centrin 2) {Human (Homo sapiens) [TaxId: 9606]}
dseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnye
efvqm

Timeline for d1yrub1:

• d1yrub1 is new in SCOP 1.75
  
• d1yrub1 appears in SCOPe 2.01
  
• d1yrub1 appears in the current release, SCOPe 2.08, called d1yrub_