SCOPe 2.05: Domain d1yrtb_: 1yrt B:

Lineage for d1yrtb_ (1yrt B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47517] (81 PDB entries)
   Uniprot P02593

8. Domain d1yrtb_: 1yrt B: [145923]
   automated match to d1cmga_
   complexed with ca

Details for d1yrtb_

PDB Entry: 1yrt, 2.1 Å

PDB Description: Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of Bordetella pertussis in presence of c-terminal calmodulin

PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d1yrtb_:

Sequence; same for both SEQRES and ATOM records:

>d1yrtb_ a.39.1.5 (B:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
eefvqmmta

Timeline for d1yrtb_:

• d1yrtb_ first appeared in SCOP 1.75, called d1yrtb1
  
• d1yrtb_ appears in SCOPe 2.04
  
• d1yrtb_ appears in SCOPe 2.06
  
• d1yrtb_ appears in the current release, SCOPe 2.08