Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Caltractin (centrin 2) [89053] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89054] (5 PDB entries) |
Domain d1yrtb1: 1yrt B:80-144 [145923] automatically matched to d1m39a_ complexed with ca |
PDB Entry: 1yrt (more details), 2.1 Å
SCOP Domain Sequences for d1yrtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrtb1 a.39.1.5 (B:80-144) Caltractin (centrin 2) {Human (Homo sapiens) [TaxId: 9606]} dseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnye efvqm
Timeline for d1yrtb1: