![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species) |
![]() | Species Neisseria meningitidis, serogroup B [TaxId:487] [117435] (3 PDB entries) Uniprot Q9K1N1 |
![]() | Domain d1yqga2: 1yqg A:1-152 [145921] Other proteins in same PDB: d1yqga1 complexed with so4 |
PDB Entry: 1yqg (more details), 1.9 Å
SCOPe Domain Sequences for d1yqga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddv lilavkpqdmeaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglg vsgmyaeaevsetdrriadrimksvgltvwld
Timeline for d1yqga2: