SCOPe 2.01: Domain d1yqga1: 1yqg A:153-263

Lineage for d1yqga1 (1yqg A:153-263)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
   similar dimer to the class I KARI

6. Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)

7. Species Neisseria meningitidis, serogroup B [TaxId:487] [116986] (2 PDB entries)
   Uniprot Q9K1N1

8. Domain d1yqga1: 1yqg A:153-263 [145920]
   Other proteins in same PDB: d1yqga2
   complexed with so4

Details for d1yqga1

PDB Entry: 1yqg, 1.9 Å

PDB Description: Crystal structure of a pyrroline-5-carboxylate reductase from neisseria meningitides mc58

PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d1yqga1:

Sequence; same for both SEQRES and ATOM records:

>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
deekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalaeqtge
dfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq

Timeline for d1yqga1:

• d1yqga1 first appeared in SCOP 1.75
  
• d1yqga1 appears in SCOPe 2.02
  
• d1yqga1 appears in the current release, SCOPe 2.08