Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
Protein Aquaporin-0 [103468] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [118226] (2 PDB entries) Uniprot P06624 |
Domain d1ymga1: 1ymg A:6-239 [145918] complexed with bng |
PDB Entry: 1ymg (more details), 2.24 Å
SCOPe Domain Sequences for d1ymga1:
Sequence, based on SEQRES records: (download)
>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
Timeline for d1ymga1: