Lineage for d1ymga1 (1ymg A:6-239)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024310Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 3024329Protein Aquaporin-0 [103468] (2 species)
  7. 3024330Species Cow (Bos taurus) [TaxId:9913] [118226] (2 PDB entries)
    Uniprot P06624
  8. 3024331Domain d1ymga1: 1ymg A:6-239 [145918]
    complexed with bng

Details for d1ymga1

PDB Entry: 1ymg (more details), 2.24 Å

PDB Description: the channel architecture of aquaporin o at 2.2 angstrom resolution
PDB Compounds: (A:) lens fiber major intrinsic protein

SCOPe Domain Sequences for d1ymga1:

Sequence, based on SEQRES records: (download)

>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]}
sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga
hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv
svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp
arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

Sequence, based on observed residues (ATOM records): (download)

>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]}
sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah
vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs
vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa
rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

SCOPe Domain Coordinates for d1ymga1:

Click to download the PDB-style file with coordinates for d1ymga1.
(The format of our PDB-style files is described here.)

Timeline for d1ymga1: