![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.2: PHBH-like [54378] (4 proteins) |
![]() | Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries) |
![]() | Domain d1ykjb2: 1ykj B:2174-2275 [145917] Other proteins in same PDB: d1ykja1, d1ykjb1 automatically matched to d1d7la2 complexed with fad, phb, psl, so4 |
PDB Entry: 1ykj (more details), 2 Å
SCOPe Domain Sequences for d1ykjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykjb2 d.16.1.2 (B:2174-2275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]} lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
Timeline for d1ykjb2: