Lineage for d1ykja1 (1ykj A:1001-1173,A:1276-1394)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109396Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2109611Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 2109612Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries)
  8. 2109622Domain d1ykja1: 1ykj A:1001-1173,A:1276-1394 [145914]
    Other proteins in same PDB: d1ykja2, d1ykjb2
    automatically matched to d1d7la1
    complexed with fad, phb, psl, so4

Details for d1ykja1

PDB Entry: 1ykj (more details), 2 Å

PDB Description: a45g p-hydroxybenzoate hydroxylase with p-hydroxybenzoate bound
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1ykja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykja1 c.3.1.2 (A:1001-1173,A:1276-1394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOPe Domain Coordinates for d1ykja1:

Click to download the PDB-style file with coordinates for d1ykja1.
(The format of our PDB-style files is described here.)

Timeline for d1ykja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykja2