SCOP 1.75: Domain d1ykja1: 1ykj A:1001-1173,A:1276-1394

Lineage for d1ykja1 (1ykj A:1001-1173,A:1276-1394)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries)

8. Domain d1ykja1: 1ykj A:1001-1173,A:1276-1394 [145914]
   Other proteins in same PDB: d1ykja2, d1ykjb2
   automatically matched to d1d7la1
   complexed with fad, phb, psl, so4; mutant

Details for d1ykja1

PDB Entry: 1ykj, 2 Å

PDB Description: a45g p-hydroxybenzoate hydroxylase with p-hydroxybenzoate bound

PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOP Domain Sequences for d1ykja1:

Sequence; same for both SEQRES and ATOM records:

>d1ykja1 c.3.1.2 (A:1001-1173,A:1276-1394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

Timeline for d1ykja1:

• d1ykja1 is new in SCOP 1.75
  
• d1ykja1 appears in SCOPe 2.01
  
• d1ykja1 appears in the current release, SCOPe 2.08