Lineage for d1y6wa_ (1y6w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710701Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
    Uniprot P02593
  8. 2710771Domain d1y6wa_: 1y6w A: [145912]
    automated match to d1cfca_
    complexed with ca, mpd, tbu

Details for d1y6wa_

PDB Entry: 1y6w (more details), 2.4 Å

PDB Description: trapped intermediate of calmodulin
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1y6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6wa_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgcnpteaelqdminevdadgngt
infpefltmmarcmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvqmmta

SCOPe Domain Coordinates for d1y6wa_:

Click to download the PDB-style file with coordinates for d1y6wa_.
(The format of our PDB-style files is described here.)

Timeline for d1y6wa_: