SCOPe 2.01: Domain d1y6eb1: 1y6e B:81-216

Lineage for d1y6eb1 (1y6e B:81-216)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries)
   Uniprot P08515

8. Domain d1y6eb1: 1y6e B:81-216 [145910]
   Other proteins in same PDB: d1y6ea2, d1y6eb2
   automatically matched to d2fhea1

Details for d1y6eb1

PDB Entry: 1y6e, 3 Å

PDB Description: Orthorhombic glutathione S-transferase of Schistosoma japonicum

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1y6eb1:

Sequence; same for both SEQRES and ATOM records:

>d1y6eb1 a.45.1.1 (B:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhpp

Timeline for d1y6eb1:

• d1y6eb1 first appeared in SCOP 1.75
  
• d1y6eb1 appears in SCOPe 2.02
  
• d1y6eb1 appears in the current release, SCOPe 2.08