SCOPe 2.03: Domain d1y6ea2: 1y6e A:4-80

Lineage for d1y6ea2 (1y6e A:4-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (14 PDB entries)
   Uniprot P08515

8. Domain d1y6ea2: 1y6e A:4-80 [145909]
   Other proteins in same PDB: d1y6ea1, d1y6eb1
   automatically matched to d2fhea2

Details for d1y6ea2

PDB Entry: 1y6e, 3 Å

PDB Description: Orthorhombic glutathione S-transferase of Schistosoma japonicum

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1y6ea2:

Sequence; same for both SEQRES and ATOM records:

>d1y6ea2 c.47.1.5 (A:4-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvk
ltqsmaiiryiadkhnm

Timeline for d1y6ea2:

• d1y6ea2 first appeared in SCOP 1.75
  
• d1y6ea2 appears in SCOPe 2.02
  
• d1y6ea2 appears in SCOPe 2.04
  
• d1y6ea2 appears in the current release, SCOPe 2.08