Lineage for d1y6ea1 (1y6e A:80-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713714Species Schistosoma japonicum [TaxId:6182] [225615] (2 PDB entries)
  8. 2713715Domain d1y6ea1: 1y6e A:80-216 [145908]
    Other proteins in same PDB: d1y6ea2, d1y6eb2
    automated match to d1gnea1

Details for d1y6ea1

PDB Entry: 1y6e (more details), 3 Å

PDB Description: Orthorhombic glutathione S-transferase of Schistosoma japonicum
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1y6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6ea1 a.45.1.1 (A:80-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhpp

SCOPe Domain Coordinates for d1y6ea1:

Click to download the PDB-style file with coordinates for d1y6ea1.
(The format of our PDB-style files is described here.)

Timeline for d1y6ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6ea2