![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) ![]() rudiment single hybrid fold with a permuted topology |
![]() | Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
![]() | Protein Ribosomal protein L27 [110326] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries) Uniprot Q9RY65 2-85 |
![]() | Domain d1y69u1: 1y69 U:2-85 [145907] Other proteins in same PDB: d1y69k1 automatically matched to 2ZJR T:2-85 |
PDB Entry: 1y69 (more details), 3.33 Å
SCOPe Domain Sequences for d1y69u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y69u1 b.84.4.1 (U:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]} ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa lsdgkvvfinkgkgarfisieaaq
Timeline for d1y69u1: