Lineage for d1y69u1 (1y69 U:2-85)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964158Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 964353Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 964354Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 964355Protein Ribosomal protein L27 [110326] (3 species)
  7. 964356Species Deinococcus radiodurans [TaxId:1299] [159323] (11 PDB entries)
    Uniprot Q9RY65 2-85
  8. 964358Domain d1y69u1: 1y69 U:2-85 [145907]
    Other proteins in same PDB: d1y69k1
    automatically matched to 2ZJR T:2-85

Details for d1y69u1

PDB Entry: 1y69 (more details), 3.33 Å

PDB Description: rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
PDB Compounds: (U:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1y69u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y69u1 b.84.4.1 (U:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOPe Domain Coordinates for d1y69u1:

Click to download the PDB-style file with coordinates for d1y69u1.
(The format of our PDB-style files is described here.)

Timeline for d1y69u1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y69k1