SCOPe 2.08: Domain d1y69u1: 1y69 U:2-85

Lineage for d1y69u1 (1y69 U:2-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
   Pfam PF01016

6. Protein Ribosomal protein L27 [110326] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
   Uniprot Q9RY65 2-85

8. Domain d1y69u1: 1y69 U:2-85 [145907]
   Other proteins in same PDB: d1y69k1
   automatically matched to 2ZJR T:2-85

Details for d1y69u1

PDB Entry: 1y69, 3.33 Å

PDB Description: rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans

PDB Compounds: (U:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1y69u1:

Sequence; same for both SEQRES and ATOM records:

>d1y69u1 b.84.4.1 (U:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

Timeline for d1y69u1:

• d1y69u1 first appeared in SCOP 1.75
  
• d1y69u1 appears in SCOPe 2.07