SCOPe 2.05: Domain d1y69k1: 1y69 K:6-141

Lineage for d1y69k1 (1y69 K:6-141)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
   Pfam PF00252

6. Protein Ribosomal protein L16p [117889] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160196] (6 PDB entries)
   Uniprot Q9RXJ5 5-140

8. Domain d1y69k1: 1y69 K:6-141 [145906]
   Other proteins in same PDB: d1y69u1
   automatically matched to 2ZJR J:6-141

Details for d1y69k1

PDB Entry: 1y69, 3.33 Å

PDB Description: rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans

PDB Compounds: (K:) 50S ribosomal protein L16

SCOPe Domain Sequences for d1y69k1:

Sequence; same for both SEQRES and ATOM records:

>d1y69k1 d.41.4.2 (K:6-141) Ribosomal protein L16p {Deinococcus radiodurans [TaxId: 1299]}
krtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggki
yirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghk
lpiqtkmvkrevydea

Timeline for d1y69k1:

• d1y69k1 first appeared in SCOP 1.75
  
• d1y69k1 appears in SCOPe 2.04
  
• d1y69k1 appears in SCOPe 2.06
  
• d1y69k1 appears in the current release, SCOPe 2.07