Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-src tyrosine kinase [56155] (3 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56156] (13 PDB entries) |
Domain d1y57a3: 1y57 A:249-533 [145905] Other proteins in same PDB: d1y57a1, d1y57a2 automated match to d1fmka3 complexed with mpz, so4 |
PDB Entry: 1y57 (more details), 1.91 Å
SCOPe Domain Sequences for d1y57a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y57a3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
Timeline for d1y57a3: