SCOPe 2.05: Domain d1y57a3: 1y57 A:249-533

Lineage for d1y57a3 (1y57 A:249-533)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (2 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56156] (12 PDB entries)

8. Domain d1y57a3: 1y57 A:249-533 [145905]
   Other proteins in same PDB: d1y57a1, d1y57a2
   automated match to d1fmka3
   complexed with mpz, so4

Details for d1y57a3

PDB Entry: 1y57, 1.91 Å

PDB Description: structure of unphosphorylated c-src in complex with an inhibitor

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1y57a3:

Sequence; same for both SEQRES and ATOM records:

>d1y57a3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

Timeline for d1y57a3:

• d1y57a3 first appeared in SCOP 1.75
  
• d1y57a3 appears in SCOPe 2.04
  
• d1y57a3 appears in SCOPe 2.06
  
• d1y57a3 appears in the current release, SCOPe 2.08