Lineage for d1y57a3 (1y57 A:249-533)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672024Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1672095Species Human (Homo sapiens) [TaxId:9606] [56156] (12 PDB entries)
  8. 1672098Domain d1y57a3: 1y57 A:249-533 [145905]
    Other proteins in same PDB: d1y57a1, d1y57a2
    automated match to d1fmka3
    complexed with mpz, so4

Details for d1y57a3

PDB Entry: 1y57 (more details), 1.91 Å

PDB Description: structure of unphosphorylated c-src in complex with an inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1y57a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y57a3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

SCOPe Domain Coordinates for d1y57a3:

Click to download the PDB-style file with coordinates for d1y57a3.
(The format of our PDB-style files is described here.)

Timeline for d1y57a3: