Lineage for d1y57a2 (1y57 A:146-248)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2571859Protein c-src tyrosine kinase [55556] (4 species)
  7. 2571866Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 2571914Domain d1y57a2: 1y57 A:146-248 [145904]
    Other proteins in same PDB: d1y57a1, d1y57a3
    automated match to d1fmka2
    complexed with mpz, so4

Details for d1y57a2

PDB Entry: 1y57 (more details), 1.91 Å

PDB Description: structure of unphosphorylated c-src in complex with an inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1y57a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y57a2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOPe Domain Coordinates for d1y57a2:

Click to download the PDB-style file with coordinates for d1y57a2.
(The format of our PDB-style files is described here.)

Timeline for d1y57a2: