Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries) |
Domain d1y57a2: 1y57 A:146-248 [145904] Other proteins in same PDB: d1y57a1, d1y57a3 automated match to d1fmka2 complexed with mpz, so4 |
PDB Entry: 1y57 (more details), 1.91 Å
SCOPe Domain Sequences for d1y57a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y57a2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts
Timeline for d1y57a2: