SCOP 1.75: Domain d1y57a2: 1y57 A:141-246

Lineage for d1y57a2 (1y57 A:141-246)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (42 PDB entries)

8. Domain d1y57a2: 1y57 A:141-246 [145904]
   Other proteins in same PDB: d1y57a1, d1y57a3
   automatically matched to d1hcsb_
   complexed with mpz, so4

Details for d1y57a2

PDB Entry: 1y57, 1.91 Å

PDB Description: structure of unphosphorylated c-src in complex with an inhibitor

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d1y57a2:

Sequence; same for both SEQRES and ATOM records:

>d1y57a2 d.93.1.1 (A:141-246) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
dsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvk
hykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

Timeline for d1y57a2:

• d1y57a2 is new in SCOP 1.75
  
• d1y57a2 appears in SCOPe 2.01
  
• d1y57a2 appears in the current release, SCOPe 2.08