Lineage for d1y4ob1 (1y4o B:210-304)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870994Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 870995Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
    Pfam PF03259
  6. 870996Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. 871006Species Mouse (Mus musculus) [TaxId:10090] [160682] (1 PDB entry)
    Uniprot P62627 1-95
  8. 871008Domain d1y4ob1: 1y4o B:210-304 [145902]
    automatically matched to 1Y4O A:10-104

Details for d1y4ob1

PDB Entry: 1y4o (more details)

PDB Description: solution structure of a mouse cytoplasmic roadblock/lc7 dynein light chain
PDB Compounds: (B:) Dynein light chain 2A, cytoplasmic

SCOP Domain Sequences for d1y4ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4ob1 d.110.7.1 (B:210-304) Dynein light chain 2A, cytoplasmic {Mouse (Mus musculus) [TaxId: 10090]}
aeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilkarstvreid
pqndltflrirskkneimvapdkdyfliviqnpte

SCOP Domain Coordinates for d1y4ob1:

Click to download the PDB-style file with coordinates for d1y4ob1.
(The format of our PDB-style files is described here.)

Timeline for d1y4ob1: