SCOPe 2.05: Domain d1y4oa1: 1y4o A:10-104

Lineage for d1y4oa1 (1y4o A:10-104)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [160682] (1 PDB entry)
   Uniprot P62627 1-95

8. Domain d1y4oa1: 1y4o A:10-104 [145901]

Details for d1y4oa1

PDB Entry: 1y4o

PDB Description: solution structure of a mouse cytoplasmic roadblock/lc7 dynein light chain

PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d1y4oa1:

Sequence; same for both SEQRES and ATOM records:

>d1y4oa1 d.110.7.1 (A:10-104) Dynein light chain 2A, cytoplasmic {Mouse (Mus musculus) [TaxId: 10090]}
aeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilkarstvreid
pqndltflrirskkneimvapdkdyfliviqnpte

Timeline for d1y4oa1:

• d1y4oa1 first appeared in SCOP 1.75
  
• d1y4oa1 appears in SCOPe 2.04
  
• d1y4oa1 appears in SCOPe 2.06
  
• d1y4oa1 appears in the current release, SCOPe 2.08