Lineage for d1y4oa1 (1y4o A:10-104)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665969Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 1665970Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 1665971Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. 1665976Species Mouse (Mus musculus) [TaxId:10090] [160682] (1 PDB entry)
    Uniprot P62627 1-95
  8. 1665977Domain d1y4oa1: 1y4o A:10-104 [145901]

Details for d1y4oa1

PDB Entry: 1y4o (more details)

PDB Description: solution structure of a mouse cytoplasmic roadblock/lc7 dynein light chain
PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d1y4oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4oa1 d.110.7.1 (A:10-104) Dynein light chain 2A, cytoplasmic {Mouse (Mus musculus) [TaxId: 10090]}
aeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilkarstvreid
pqndltflrirskkneimvapdkdyfliviqnpte

SCOPe Domain Coordinates for d1y4oa1:

Click to download the PDB-style file with coordinates for d1y4oa1.
(The format of our PDB-style files is described here.)

Timeline for d1y4oa1: