![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
![]() | Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
![]() | Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries) |
![]() | Domain d1y39a1: 1y39 A:2-75 [145899] complexed with 3co, gol, gtp, k, mg; mutant |
PDB Entry: 1y39 (more details), 2.8 Å
SCOP Domain Sequences for d1y39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y39a1 a.4.7.1 (A:2-75) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} tfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamr miegtarnmgivve
Timeline for d1y39a1: