Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (13 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (20 PDB entries) |
Domain d1y0vl1: 1y0v L:5-148 [145897] Other proteins in same PDB: d1y0vh2, d1y0vi2, d1y0vj2, d1y0vk2, d1y0vl2, d1y0vm2 automatically matched to d2bbma_ complexed with ca, mg, pop |
PDB Entry: 1y0v (more details), 3.6 Å
SCOPe Domain Sequences for d1y0vl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0vl1 a.39.1.5 (L:5-148) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmtak
Timeline for d1y0vl1: