Lineage for d1xw3a1 (1xw3 A:32-137)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins)
    PfamB PB015736
  6. Protein Sulfiredoxin [160096] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries)
    Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137
  8. Domain d1xw3a1: 1xw3 A:32-137 [145891]
    Other proteins in same PDB: d1xw3a2
    complexed with mpd, po4

Details for d1xw3a1

PDB Entry: 1xw3 (more details), 1.6500000000000001 Å

PDB Description: crystal structure of human sulfiredoxin (srx)
PDB Compounds: (A:) Sulfiredoxin

SCOPe Domain Sequences for d1xw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw3a1 d.268.1.4 (A:32-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]}
sihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqggd
yfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq

SCOPe Domain Coordinates for d1xw3a1 are not available.

Timeline for d1xw3a1:

Domains from same chain:
(mouse over for more information)
d1xw3a2