SCOPe 2.07: Domain d1xbpz1: 1xbp Z:2-59

Lineage for d1xbpz1 (1xbp Z:2-59)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
   Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail

6. Protein Ribosomal protein L32p [144201] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [161178] (6 PDB entries)
   Uniprot P49228 2-59

8. Domain d1xbpz1: 1xbp Z:2-59 [145889]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1
   automatically matched to 2ZJR Z:2-59
   complexed with mul

Details for d1xbpz1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (Z:) 50S ribosomal protein L32

SCOPe Domain Sequences for d1xbpz1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

Timeline for d1xbpz1:

• d1xbpz1 first appeared in SCOP 1.75
  
• d1xbpz1 appears in SCOPe 2.06
  
• d1xbpz1 appears in the current release, SCOPe 2.08