Lineage for d1xbpz1 (1xbp Z:2-59)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066627Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 1066628Protein Ribosomal protein L32p [144201] (3 species)
  7. 1066629Species Deinococcus radiodurans [TaxId:1299] [161178] (10 PDB entries)
    Uniprot P49228 2-59
  8. 1066635Domain d1xbpz1: 1xbp Z:2-59 [145889]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1
    automatically matched to 2ZJR Z:2-59
    complexed with mul

Details for d1xbpz1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (Z:) 50S ribosomal protein L32

SCOPe Domain Sequences for d1xbpz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d1xbpz1:

Click to download the PDB-style file with coordinates for d1xbpz1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpz1: