SCOP 1.75: Domain d1xbpx1: 1xbp X:1-55

Lineage for d1xbpx1 (1xbp X:1-55)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
   Uniprot Q9RSL0 1-55

8. Domain d1xbpx1: 1xbp X:1-55 [145888]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpz1
   automatically matched to 2ZJR W:1-55
   complexed with mul

Details for d1xbpx1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (X:) 50S ribosomal protein L30

SCOP Domain Sequences for d1xbpx1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpx1 d.59.1.1 (X:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

Timeline for d1xbpx1:

• d1xbpx1 is new in SCOP 1.75
  
• d1xbpx1 appears in SCOPe 2.01
  
• d1xbpx1 appears in the current release, SCOPe 2.08