Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) automatically mapped to Pfam PF00831 |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries) Uniprot Q9RXJ4 1-66 |
Domain d1xbpw1: 1xbp W:2-66 [145887] Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR V:1-66 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbpw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbpw1 a.2.2.1 (W:2-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]} kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela rkgeq
Timeline for d1xbpw1:
View in 3D Domains from other chains: (mouse over for more information) d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpx1, d1xbpz1 |