Lineage for d1xbpw1 (1xbp W:2-66)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760101Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 760102Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 760103Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 760149Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
    Uniprot Q9RXJ4 1-66
  8. 760152Domain d1xbpw1: 1xbp W:2-66 [145887]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR V:1-66
    complexed with mul

Details for d1xbpw1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (W:) 50S ribosomal protein L29

SCOP Domain Sequences for d1xbpw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpw1 a.2.2.1 (W:2-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
rkgeq

SCOP Domain Coordinates for d1xbpw1:

Click to download the PDB-style file with coordinates for d1xbpw1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpw1: