Lineage for d1xbpt1 (1xbp T:1-175)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805051Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 805052Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 805053Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 805088Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 805089Species Deinococcus radiodurans [TaxId:1299] [159200] (10 PDB entries)
    Uniprot Q9RX88 1-175
  8. 805091Domain d1xbpt1: 1xbp T:1-175 [145885]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR S:1-175
    complexed with mul

Details for d1xbpt1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (T:) 50S ribosomal protein L25

SCOP Domain Sequences for d1xbpt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpt1 b.53.1.1 (T:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOP Domain Coordinates for d1xbpt1:

Click to download the PDB-style file with coordinates for d1xbpt1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpt1: