Lineage for d1xbpp1 (1xbp P:5-98)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433987Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 2433988Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 2433989Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 2433990Protein Ribosomal protein L21p [141093] (3 species)
  7. 2433991Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries)
    Uniprot Q9RY64 5-98
  8. 2433997Domain d1xbpp1: 1xbp P:5-98 [145881]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR O:5-98
    complexed with mul

Details for d1xbpp1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (P:) 50S ribosomal protein L21

SCOPe Domain Sequences for d1xbpp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpp1 b.155.1.1 (P:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOPe Domain Coordinates for d1xbpp1:

Click to download the PDB-style file with coordinates for d1xbpp1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpp1: