SCOPe 2.02: Domain d1xbpp1: 1xbp P:5-98

Lineage for d1xbpp1 (1xbp P:5-98)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries)
   Uniprot Q9RY64 5-98

8. Domain d1xbpp1: 1xbp P:5-98 [145881]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR O:5-98
   complexed with mul

Details for d1xbpp1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (P:) 50S ribosomal protein L21

SCOPe Domain Sequences for d1xbpp1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpp1 b.155.1.1 (P:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

Timeline for d1xbpp1:

• d1xbpp1 first appeared in SCOP 1.75
  
• d1xbpp1 appears in SCOPe 2.01
  
• d1xbpp1 appears in SCOPe 2.03
  
• d1xbpp1 appears in the current release, SCOPe 2.08