![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries) Uniprot Q9RY64 5-98 |
![]() | Domain d1xbpp1: 1xbp P:5-98 [145881] Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR O:5-98 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOP Domain Sequences for d1xbpp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbpp1 b.155.1.1 (P:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]} iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d1xbpp1:
![]() Domains from other chains: (mouse over for more information) d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |