![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) ![]() automatically mapped to Pfam PF00453 |
![]() | Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
![]() | Protein Ribosomal protein L20 [74733] (4 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries) Uniprot Q9RSW7 2-118 |
![]() | Domain d1xbpo1: 1xbp O:2-118 [145880] Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR N:2-118 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbpo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbpo1 a.144.2.1 (O:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]} praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
Timeline for d1xbpo1:
![]() Domains from other chains: (mouse over for more information) d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |