Lineage for d1xbpo1 (1xbp O:2-118)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100377Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 1100396Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
  5. 1100397Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 1100398Protein Ribosomal protein L20 [74733] (4 species)
  7. 1100401Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries)
    Uniprot Q9RSW7 2-118
  8. 1100407Domain d1xbpo1: 1xbp O:2-118 [145880]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR N:2-118
    complexed with mul

Details for d1xbpo1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (O:) 50S ribosomal protein L20

SCOPe Domain Sequences for d1xbpo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpo1 a.144.2.1 (O:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d1xbpo1:

Click to download the PDB-style file with coordinates for d1xbpo1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpo1: